PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00020.1_g00053.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 391aa    MW: 45530.2 Da    PI: 5.8894
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00020.1_g00053.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.61.7e-5571361129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv++yL+kkv++k++e+ ++ik++d+yk+ePwdL++  k+ +ee+ +wyfFs++dkky+tg+r+nratk+g+W
  Rsa1.0_00020.1_g00053.1   7 VPPGFRFHPTDEELVDYYLRKKVASKRIEI-DFIKDIDLYKIEPWDLQElcKIGHEEQsDWYFFSHKDKKYPTGTRTNRATKAGFW 91 
                              69****************************.99**************9544444444359************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk+++  +++l+g++ktLvfykgrap+g+k+dW+mheyrle
  Rsa1.0_00020.1_g00053.1  92 KATGRDKAIYL-RHNLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                              ***********.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-605156IPR003441NAC domain
PROSITE profilePS5100558.9917156IPR003441NAC domain
PfamPF023651.1E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MNSFSHVPPG FRFHPTDEEL VDYYLRKKVA SKRIEIDFIK DIDLYKIEPW DLQELCKIGH  60
EEQSDWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YLRHNLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GTPHEEGWVV CRVFKKRLAA VRRMGDYDSS PSHWYDDQLS  180
FMSSELETNG PRRILPNHQH QHQHQYHLPY GFSASAYALN SPNLLCKQEL QYNHLVQNHH  240
LLHEPPLSFL QLPQLEIPIQ SQDNSNSNYF PYETSNNDTN SSHIANLQQS NLAHEEQLNQ  300
GNQVFSSPYI NSGNEQTMDQ VTDWRVLDKF VASQLSNEEA ATASASLQNN AKDTSNLEYQ  360
VDEEKEEERV SDMGEEYDAS TSSSCQIDLW K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756670.0KM975667.1 Brassica napus NAC transcription factor 7.1 (NAC7.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675224.10.0PREDICTED: NAC domain-containing protein 7 isoform X1
SwissprotQ9FWX20.0NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM4DJV50.0M4DJV5_BRARP; Uncharacterized protein
STRINGBra016783.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.10.0NAC 007